PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn379861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 468aa    MW: 51535.9 Da    PI: 6.8465
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn379861genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.11.3e-20164217155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r++W +++ ++F+ea+e L Gs++A Pk+i+e+m+v+gLt+e v+SHLQk+R+
  Achn379861 164 KKRVVWDEKMKRKFLEAIELL-GSDQAFPKKIVEVMNVPGLTRESVASHLQKHRI 217
                 68*******************.9*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.68161220IPR017930Myb domain
SuperFamilySSF466893.05E-15162221IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-21162221IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-20164217IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MSYTMRENQC CFYERERRVL RSWKMPESYC FFRQFWARLT SRGGHGPSQS SIHHLATIWS  60
SKKHVSRPLL AWLKGAMSHN ENAKLLPADF ASRVILYFLK SMSVSSFETL WQHACVKEKG  120
KATNAERASM LYENVIEESL GNTPEQTEVT ADDDSPQKNK KKNKKRVVWD EKMKRKFLEA  180
IELLGSDQAF PKKIVEVMNV PGLTRESVAS HLQKHRITMK RAQGASFPSS QFALNFNSSQ  240
GNPETKFYQL GSSSSISLPS SNFSPLFHTE ASTSRSNLIH EPYGLGVSSP DAIAIAQTSI  300
NLLDYVTSLP TSQPGSAQVA SGLVPGSRVN QTYGIETILP RIDIGGSSSN PNSTYVGFRL  360
AANGKVESGQ TGVTSNDEKK TVVVNLSAEG AENESLVQYP STSVDHVAQQ PPSLPPMVPS  420
IPHDFESLGA DVEIDALMNM AGSGGIFWED DFDDPIFHNS LDLGFVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-14162221362ARR10-B
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159175KKKNKKRVVWDEKMKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-20response regulator 2